General Information

  • ID:  hor007282
  • Uniprot ID:  Q9QXU1??17-172)
  • Protein name:  Male-specific submandibular salivary gland protein
  • Gene name:  NA
  • Organism:  Mesocricetus auratus
  • Family:  Lipocalin family
  • Source:  Animal
  • Expression:  Expressed in acinar cells of the submandibular salivary gland from where it is secreted into saliva (at protein level) (PubMed-10561587; PubMed-8809199; PubMed-23453961). Also released from the subman
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Cricetidae; Cricetinae (hamsters); Mesocricetus; Mesocricetus auratus (Golden hamster)
  • GO MF:  GO:0005737 cytoplasm; GO:0005615 extracellular space
  • GO BP:  GO:0005549 odorant binding; GO:0036094 small molecule binding
  • GO CC:  NA

Sequence Information

  • Sequence:  QHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLECSDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ
  • Length:  156
  • Propeptide:  MVKFLLLALALGVSCAQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLECSDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ
  • Signal peptide:  MVKFLLLALALGVSC
  • Modification:  T103 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA